PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00248g00125.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 417aa    MW: 45600.7 Da    PI: 6.3959
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00248g00125.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.94.7e-28149203156
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                               k +++WtpeLH+rFv+aveqL G +kA+P++ilelm+++gLt+++++SHLQkYR++
  Peaxi162Scf00248g00125.1 149 KVKVDWTPELHRRFVQAVEQL-GLDKAVPSRILELMGIDGLTRHNIASHLQKYRSH 203
                               5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.608146205IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-27147206IPR009057Homeodomain-like
SuperFamilySSF466891.25E-18148206IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-26149203IPR006447Myb domain, plants
PfamPF002491.2E-9152201IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MLAVSPLTYN SIKDDQRDNE IECFPDFADG NLLDSIDFDE LFMGINDGDV LPDLEMDSEI  60
LAEFSVSSGD ESDINNNYYT VTTPEDNSSR KYEVEKAPSD LTSLNKGEEC VSKKNEEPGS  120
INVKTKSKEN NDKGKKSSGQ SNKPEGKRKV KVDWTPELHR RFVQAVEQLG LDKAVPSRIL  180
ELMGIDGLTR HNIASHLQKY RSHRKHLLAR EAEAASWNQR RQIYGGAAAG AGGKRDINPW  240
PAPTMGFPPM TPPSMPHFRP LHVWGHPSVD QSMMHVWPKQ PAPPAWAAPP VVPPHPLSPT  300
EPSFWHSHHQ RVSNSLAPGT PCFPAPIAPT RFPVLPVPGI PPAAMIKAAS TGAGLDLPIP  360
PCDFHASKEN IDAAIEDVLA KPCLPLPLGL KPPSIDSVLK ELQRQGITKV PPTVSGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-16146201257ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016477567.11e-178PREDICTED: transcription activator GLK1-like
SwissprotQ9SIV39e-98GLK1_ARATH; Transcription activator GLK1
TrEMBLM1AJS11e-159M1AJS1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000242651e-158(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.11e-90GBF's pro-rich region-interacting factor 1